General Information

  • ID:  hor005174
  • Uniprot ID:  P08989
  • Protein name:  Gastrin-releasing peptide
  • Gene name:  GRP
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0035176 social behavior; GO:0036343 psychomotor behavior; GO:0043207 response to external biotic stimulus; GO:0043303 mast cell degranulation; GO:0090277 positive regulation of peptide hormone secretion; GO:1900738 positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway; GO:1903817 negative regulation of voltage-gated potassium channel activity; GO:1903942 positive regulation of respiratory gaseous exchange; GO:1905151 negative regulation of voltage-gated sodium channel activity; GO:2000987 positive regulation of behavioral fear response
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0031410 cytoplasmic vesicle; GO:0034774 secretory granule lumen; GO:0042995 cell projection; GO:0043005 neuron projection

Sequence Information

  • Sequence:  APVPGGQGTVLDKMYPRGNHWAVGHLM
  • Length:  27(24-50)
  • Propeptide:  MRGRELPLVLLALVLCQAPRGPAAPVPGGQGTVLDKMYPRGNHWAVGHLMGKKSTRESPYVYEEGSLKQQLQGYIRWEEAARNLLSLMEAKGTRSHQTPQREPLGIRQSAWDYQDDSNFKVIGPTREVGGLSASGSQPEGRNPPRN
  • Signal peptide:  MRGRELPLVLLALVLCQAPRGPA
  • Modification:  T27 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the release of gastrin and other gastrointestinal hormones (By similarity). Contributes to the perception of prurient stimuli and to the transmission of itch signals in the spinal cord that promote scratching behavior. Contributes primarily to
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P08989-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005174_AF2.pdbhor005174_ESM.pdb

Physical Information

Mass: 335330 Formula: C129H198N38O34S2
Absent amino acids: CEFIS Common amino acids: G
pI: 9.3 Basic residues: 4
Polar residues: 8 Hydrophobic residues: 8
Hydrophobicity: -27.41 Boman Index: -1609
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 68.52
Instability Index: 3586.67 Extinction Coefficient cystines: 6990
Absorbance 280nm: 268.85

Literature

  • PubMed ID:  6853532
  • Title:  Amino acid sequences of three bombesin-like peptides from canine intestine extracts.